PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bHLH
Protein Properties Length: 180aa    MW: 19672.5 Da    PI: 10.0589
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011172genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH382.9e-121462555
                 HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                  +++Er+RR+++++ +++L +l+P++   +++ +s  + L +A +YIk+Lq
  Lus10011172 14 RKAIERNRRNQMKELYSNLSSLVPPQ--ISKEPVSLPDQLDHAAKYIKKLQ 62
                 589**********************8..36666*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000835.19E-7966No hitNo description
PROSITE profilePS5088812.265961IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474598.9E-121476IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.4E-111477IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.5E-51567IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-81562IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0050832Biological Processdefense response to fungus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEKKPNPASC SRDRKAIERN RRNQMKELYS NLSSLVPPQI SKEPVSLPDQ LDHAAKYIKK  60
LQTNLEKLRL KKERLSATAG NSGDETAPAI RAGTCRPPKI EIREMGSALE VVLITGSDSK  120
FVFNDTIRVI QEEDGEIVNA SFSVSKDLVF HTIHSKIGGG GGAARISERL KKIVGEYGG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091614.19e-68PREDICTED: uncharacterized protein LOC105649551
TrEMBLU5G1002e-63U5G100_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05320.16e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.15e-41bHLH family protein